PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_008233367.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; fabids; Rosales; Rosaceae; Maloideae; Amygdaleae; Prunus
Family LBD
Protein Properties Length: 230aa    MW: 25154.7 Da    PI: 6.7195
Description LBD family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_008233367.1genomeBGIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1DUF260133.49e-42741731100
          DUF260   1 aCaaCkvlrrkCakdCvlapyfpaeqpkkfanvhklFGasnvlkllkalpeeeredamsslvyeAearardPvyGavgvilklqqqleqlkaela 95 
                     +CaaCk+lrr+Ca++Cvlapyfp ++p kf ++h++FGasn++kll++lpe++r da+ss+vyeA+ar+rdPvyG++g i +lq++l++l+a+la
  XP_008233367.1  74 PCAACKILRRRCAEKCVLAPYFPPTEPLKFTIAHRVFGASNIIKLLQELPESHRADAVSSMVYEANARIRDPVYGCAGAICQLQKHLSELQAQLA 168
                     7********************************************************************************************** PP

          DUF260  96 llkee 100
                     ++++e
  XP_008233367.1 169 KTQAE 173
                     *9987 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
PROSITE profilePS5089125.94573174IPR004883Lateral organ boundaries, LOB
PfamPF031955.3E-4274171IPR004883Lateral organ boundaries, LOB
Sequence ? help Back to Top
Protein Sequence    Length: 230 aa     Download sequence    Send to blast
MEFNTSTPSA SSPPLSISQL SSPTASFPSP NNPLQLSNLS SPNYAVKNNN SIINTSINNP  60
TSPSPPPPPV VLSPCAACKI LRRRCAEKCV LAPYFPPTEP LKFTIAHRVF GASNIIKLLQ  120
ELPESHRADA VSSMVYEANA RIRDPVYGCA GAICQLQKHL SELQAQLAKT QAELLNMQCQ  180
QGNLIALICM DMTQSKDPIL QQQQQQQSYL DTSCFLDETN LGTAWEPLWT
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieve-
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_008233367.11e-168PREDICTED: LOB domain-containing protein 1-like
SwissprotQ9LQR03e-73LBD1_ARATH; LOB domain-containing protein 1
TrEMBLM5X5X51e-137M5X5X5_PRUPE; Uncharacterized protein
STRINGPOPTR_0008s04350.11e-96(Populus trichocarpa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
FabidsOGEF130334106
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G07900.15e-72LOB domain-containing protein 1